PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00012996_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 110aa    MW: 12010 Da    PI: 6.5082
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00012996_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like53.17e-171302756
                           G2-like 27 AtPktilelmkvkgLtlehvkSHLQkYRla 56
                                      AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  FANhyb_icon00012996_a.1.g00001.1  1 ATPKQIRELMQVDGLTNDEVKSHLQKYRLH 30
                                      9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-15133IPR009057Homeodomain-like
SuperFamilySSF466893.05E-7133IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-13130IPR006447Myb domain, plants
PROSITE profilePS5129410.239132IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
ATPKQIRELM QVDGLTNDEV KSHLQKYRLH VRKVPASSAA EANGLWMNQD HCGDNSKANT  60
SQSRSPQGPF PRTEFAKGGQ STTGGDSTET EEDDQKSDGY SWKGACHNSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288067.15e-74PREDICTED: probable transcription factor KAN4
TrEMBLM5WFN33e-45M5WFN3_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00060.t015e-38(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.15e-18G2-like family protein